General Information

  • ID:  hor002362
  • Uniprot ID:  Q2VF17??115-121)
  • Protein name:  MMG2-DPb
  • Gene name:  MMG2
  • Organism:  Aplysia californica (California sea hare)
  • Family:  Myomodulin family
  • Source:  animal
  • Expression:  Expressed in the pedal-buccal projection neurons in the pedal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QPPLPRY
  • Length:  7(115-121)
  • Propeptide:  MWKILETCSCFLVVAVLSGLGKAQPESFSGSAVTDDSTSGANKRGWSMLRLGRGLQMLRLGKRGGSLDALRSGHQVPMLRAGRGSPDTSGRLDANELYAVLSAILDEPRDQSRRQPPLPRYGRDNNGVARDLLDALASDGESSSNFDLLSSLNNGPSYFRPAPRGGRYKRSLPDAGPADYPSLEDYLVQSRQFARPYSSRAVALPRIGRFSGSPRLQAKAVPRPRIGRQESQMREAKSAE
  • Signal peptide:  MWKILETCSCFLVVAVLSGLGKA
  • Modification:  T1 Pyrrolidone carboxylic acid;T7 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Bias egestive feeding programs toward ingestive ones, and modulate accessory radula closer (ARC) muscle contractions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2VF17-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002362_AF2.pdbhor002362_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 97721 Formula: C41H63N11O10
Absent amino acids: ACDEFGHIKMNSTVW Common amino acids: P
pI: 9.35 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 1
Hydrophobicity: -147.14 Boman Index: -1568
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 6957.14 Extinction Coefficient cystines: 1490
Absorbance 280nm: 248.33

Literature

  • PubMed ID:  16237168
  • Title:  Identification of a New Neuropeptide Precursor Reveals a Novel Source of Extrinsic Modulation in the Feeding System of Aplysia